Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os08g0123300_circ_g.1 |
ID in PlantcircBase | osa_circ_035685 |
Alias | NA |
Organism | Oryza sativa |
Position | chr8: 1284377-1285452 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os08g0123300 |
Parent gene annotation |
Conserved hypothetical protein. (Os08t0123300-01) |
Parent gene strand | - |
Alternative splicing | Os08g0123300_circ_g.2 Os08g0123300_circ_g.3 |
Support reads | 1 |
Tissues | shoot, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os08t0123300-01:4 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_017759 osi_circ_009300 |
PMCS | 0.149668905 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
1285400-1284400(+) 1284428-1284971(-) |
Potential amino acid sequence |
MSTASCWITLPSTIIASKNICLDRGI*(+) MRRLHCWSHMPRSRQIFLDAIIVDGRVIQQEAVDIKPGSEIVPGPQKDGYLLYTFDITGLND*( -) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |