Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os09g0380200_circ_g.1 |
| ID in PlantcircBase | osa_circ_039045 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr9: 12826965-12827347 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os09g0380200 |
| Parent gene annotation |
Chaperone-like protein of protochlorophyllide oxidoreductase (PO R), J-like protein, Chloroplast-localized protein containing DUF 3353, Regulation of chlorophyll biosynthesis, Chlorophyll and lu tein accumulation, Chloroplast development (Os09t0380200-01) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os09t0380200-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.310111728 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
12827139-12827132(+) 12827094-12827148(-) |
| Potential amino acid sequence |
MKSYQQRKKTKINLKTKLKKRVEESPSWVKALLGYFEVPQMDIISRRLFFFAFIAGWSIATSAE NGPAFQSTFQCFQDTGFVIPTSFLVLIVMQLKKRSGVLEISLFNSMLGMNQVKKLLKVHTRR*( +) MPSILLNKEISSTPDLFFSCITINTKKLVGITNPVSWKHWNVLWNAGPFSAEVAMLQPAMKAKK NNLLEMISICGTSKYPSSAFTHDGDSSTRFFSLVFRLILVFFRCW*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |