Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os09g0123200_circ_g.3 |
| ID in PlantcircBase | osa_circ_038458 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr9: 1797867-1798617 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os09g0123200 |
| Parent gene annotation |
Similar to Flowering time control protein isoform OsFCA-1. (Os09 t0123200-01);Similar to Flowering time control protein isoform O sFCA-1. (Os09t0123200-02) |
| Parent gene strand | + |
| Alternative splicing | Os09g0123200_circ_g.1 Os09g0123200_circ_g.2 Os09g0123200_circ_g.4 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os09t0123200-01:2 Os09t0123200-02:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.166605315 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
1797967-1798614(+) |
| Potential amino acid sequence |
MQQLQSPPQAQTHPAMQPVQQIPQAQQGQQQMQMKQQELNYTQLQTPGAIDPSRIQQWDKPEEY VLYEQQQQQQQQQKLLLLQQHQQKLAMQQLQSPPQAQTHPAMQPVQQIPQAQQGQQQMQMKQQE LNYTQLQTPGAIDPSRIQQWDKPEEYVLYEQQQQQQQQQKLLLLQQHQQKLAMQQLQSPPQAQT HPAMQPVQQIPQAQQGQQQMQMKQQELNYTQLQTPGAIDPSRIQQWDKPEEYVLYEQQQQQQQQ QKLLLLQQHQQKLAMQQLQSPPQAQTHPAMQPVQQIPQAQQGQQQMQMKQQELNYTQLQTPGAI DPSRIQQ(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |