Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d043392_circ_g.3 |
ID in PlantcircBase | zma_circ_007794 |
Alias | Zm03circ00088, zma_circ_0001273, GRMZM2G162175_C1 |
Organism | Zea mays |
Position | chr3: 198627180-198628662 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | CIRI2, find_circ |
Parent gene | Zm00001d043392 |
Parent gene annotation |
Plant cysteine oxidase 5 |
Parent gene strand | + |
Alternative splicing | Zm00001d043392_circ_g.1 Zm00001d043392_circ_g.2 |
Support reads | NA |
Tissues | leaf, endosperm, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d043392_T014:3 Zm00001d043392_T003:3 Zm00001d043392_T013:3 Zm00001d043392_T017:3 Zm00001d043392_T005:2 Zm00001d043392_T004:3 Zm00001d043392_T001:3 Zm00001d043392_T010:3 Zm00001d043392_T002:3 Zm00001d043392_T016:3 Zm00001d043392_T012:3 Zm00001d043392_T015:3 Zm00001d043392_T008:3 Zm00001d043392_T007:3 Zm00001d043392_T011:3 Zm00001d043392_T006:3 Zm00001d043392_T009:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.150084385 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
198628595-198627188(+) 198627321-198627226(+) |
Potential amino acid sequence |
MDVCMLNLMTGLTYLIIQLINYKVQG*(+) MPKIKSLSNACRVSFSPEGPISEEALERVRALLDMIRPLDVGLDNEAQIARNWSSSTRPSNGRR GRNGANQFAAPIKYLHIHECESFSMGIFCMPPSSVIPLHNHPGMTVLSKLLYGRLHAESYDWVD IPDHPIDQLQSARIGNKCSKTRLWIN*(+) |
Sponge-miRNAs | zma-miR396g-3p |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | responsive to drought stress |
Other Information | |
---|---|
References | Han et al., 2020; Ma et al., 2021b;Zhang et al., 2019 |