Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d043392_circ_g.3 |
| ID in PlantcircBase | zma_circ_007794 |
| Alias | Zm03circ00088, zma_circ_0001273, GRMZM2G162175_C1 |
| Organism | Zea mays |
| Position | chr3: 198627180-198628662 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | u-circRNA |
| Identification method | CIRI2, find_circ |
| Parent gene | Zm00001d043392 |
| Parent gene annotation |
Plant cysteine oxidase 5 |
| Parent gene strand | + |
| Alternative splicing | Zm00001d043392_circ_g.1 Zm00001d043392_circ_g.2 |
| Support reads | NA |
| Tissues | leaf, endosperm, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Zm00001d043392_T014:3 Zm00001d043392_T003:3 Zm00001d043392_T013:3 Zm00001d043392_T017:3 Zm00001d043392_T005:2 Zm00001d043392_T004:3 Zm00001d043392_T001:3 Zm00001d043392_T010:3 Zm00001d043392_T002:3 Zm00001d043392_T016:3 Zm00001d043392_T012:3 Zm00001d043392_T015:3 Zm00001d043392_T008:3 Zm00001d043392_T007:3 Zm00001d043392_T011:3 Zm00001d043392_T006:3 Zm00001d043392_T009:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.150084385 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
198628595-198627188(+) 198627321-198627226(+) |
| Potential amino acid sequence |
MDVCMLNLMTGLTYLIIQLINYKVQG*(+) MPKIKSLSNACRVSFSPEGPISEEALERVRALLDMIRPLDVGLDNEAQIARNWSSSTRPSNGRR GRNGANQFAAPIKYLHIHECESFSMGIFCMPPSSVIPLHNHPGMTVLSKLLYGRLHAESYDWVD IPDHPIDQLQSARIGNKCSKTRLWIN*(+) |
| Sponge-miRNAs | zma-miR396g-3p |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | responsive to drought stress |
| Other Information | |
|---|---|
| References | Han et al., 2020; Ma et al., 2021b;Zhang et al., 2019 |