Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0923700_circ_g.3 |
ID in PlantcircBase | osa_circ_005566 |
Alias | NA |
Organism | Oryza sativa |
Position | chr1: 40407175-40408090 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | u-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os01g0923700 |
Parent gene annotation |
Similar to Histidine kinase. (Os01t0923700-01);Similar to Histid ine kinase. (Os01t0923700-02);Similar to Histidine kinase. (Os01 t0923700-03);Histidine kinase, Abscisic acid (ABA)-induced antio xidant defense (Os01t0923700-04) |
Parent gene strand | - |
Alternative splicing | Os01g0923750_circ_g.1 Os01g0923750_circ_g.2 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os01t0923700-02:3 Os01t0923700-01:4 Os01t0923700-04:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.277948335 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
40407760-40408079(-) |
Potential amino acid sequence |
MVNVYDTTNESPISMYGDDTGSGMCHVSVLNFGDPSRKHEMHCRFEKKPPWPWLAITSSFGTLV IALLTGHIFQATVHRIAKVEDDFHKMSELKKRAEDADVAKSQFLATVSHEIRTPMNGVLGGSG* (-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |