Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0923700_circ_g.3 |
| ID in PlantcircBase | osa_circ_005566 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 40407175-40408090 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os01g0923700 |
| Parent gene annotation |
Similar to Histidine kinase. (Os01t0923700-01);Similar to Histid ine kinase. (Os01t0923700-02);Similar to Histidine kinase. (Os01 t0923700-03);Histidine kinase, Abscisic acid (ABA)-induced antio xidant defense (Os01t0923700-04) |
| Parent gene strand | - |
| Alternative splicing | Os01g0923750_circ_g.1 Os01g0923750_circ_g.2 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0923700-02:3 Os01t0923700-01:4 Os01t0923700-04:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.277948335 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
40407760-40408079(-) |
| Potential amino acid sequence |
MVNVYDTTNESPISMYGDDTGSGMCHVSVLNFGDPSRKHEMHCRFEKKPPWPWLAITSSFGTLV IALLTGHIFQATVHRIAKVEDDFHKMSELKKRAEDADVAKSQFLATVSHEIRTPMNGVLGGSG* (-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |