Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Solyc03g097870.2_circ_g.1 |
| ID in PlantcircBase | sly_circ_001093 |
| Alias | SL3.0ch03:61624219|61625049 |
| Organism | Solanum lycopersicum |
| Position | chr3: 60190186-60191016 JBrowse» |
| Reference genome | SL2.50.38 |
| Type | e-circRNA |
| Identification method | CIRI; find_circ |
| Parent gene | Solyc03g097870.2 |
| Parent gene annotation |
Bidirectional sugar transporter SWEET |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Solyc03g097870.2.1:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.220883153 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
60190400-60190423(+) |
| Potential amino acid sequence |
MLWIYYALLKSNMPLLITINSFGMFIETIYVGFYLFYAPKKARVHTIKMLMLSVVGGFGAIVLV TEFLFKGVVRGQIVGWICLIFSLCVFVAPLGIVRQVIKTKSVEYMPLLLSVFLTLSAVMWFFYG LLLKDINIAVTLSRSLCSFLQYPRSIAFTRRNQQKGINQFHTWLRSLVRCFGYIMHF*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | responsive to low-temperature stress (acting as miRNA sponges) |
| Other Information | |
|---|---|
| References | Yang et al., 2020 |