Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0730800_circ_g.5 |
| ID in PlantcircBase | osa_circ_021640 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 29902183-29902284 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os03g0730800 |
| Parent gene annotation |
Calcium-transporting ATPase 3, endoplasmic reticulum-type (EC 3. 6.3.8). (Os03t0730800-01) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os03t0730800-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.34395768 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
29902193-29902281(+) |
| Potential amino acid sequence |
MNGAPKKTTMRRISEVSNIYNPNKNTDPCYHFKIMNGAPKKTTMRRISEVSNIYNPNKNTDPCY HFKIMNGAPKKTTMRRISEVSNIYNPNKNTDPCYHFKIMNGAPKKTTMRRISEVSNIYNPNKNT DPCYH(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |