Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os05g0539800_circ_g.2 |
ID in PlantcircBase | osa_circ_028701 |
Alias | NA |
Organism | Oryza sativa |
Position | chr5: 26816858-26817241 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os05g0539800 |
Parent gene annotation |
Protein of unknown function DUF778 family protein. (Os05t0539800 -01);Protein of unknown function DUF778 family protein. (Os05t05 39800-02) |
Parent gene strand | - |
Alternative splicing | Os05g0539800_circ_g.3 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os05t0539800-02:1 Os05t0539800-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_015709 |
PMCS | 0.166966363 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
26817216-26816926(+) 26817141-26817226(-) 26816912-26817231(-) |
Potential amino acid sequence |
MILSTYNKTLSPVELEVPRSRTICKVIYTHKI*(+) MEVEAACGDGVVSSSNEMQELWPLGEVDQKGTRFPCCIVWTPLPVVSWLAPYIGHVGIAREDGT VMDFAGSNFVSVDDLAYGSAARYLQLDRRKCFIVG*(-) MTLHMVLLRGTSSSTGESVLL*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |