Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0539800_circ_g.2 |
| ID in PlantcircBase | osa_circ_028701 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr5: 26816858-26817241 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os05g0539800 |
| Parent gene annotation |
Protein of unknown function DUF778 family protein. (Os05t0539800 -01);Protein of unknown function DUF778 family protein. (Os05t05 39800-02) |
| Parent gene strand | - |
| Alternative splicing | Os05g0539800_circ_g.3 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os05t0539800-02:1 Os05t0539800-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_015709 |
| PMCS | 0.166966363 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
26817216-26816926(+) 26817141-26817226(-) 26816912-26817231(-) |
| Potential amino acid sequence |
MILSTYNKTLSPVELEVPRSRTICKVIYTHKI*(+) MEVEAACGDGVVSSSNEMQELWPLGEVDQKGTRFPCCIVWTPLPVVSWLAPYIGHVGIAREDGT VMDFAGSNFVSVDDLAYGSAARYLQLDRRKCFIVG*(-) MTLHMVLLRGTSSSTGESVLL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |