Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT5G45360_circ_g.1 |
| ID in PlantcircBase | ath_circ_042529 |
| Alias | At_ciR1127, Ath_circ_FC3672, AT5G45360_C1 |
| Organism | Arabidpsis thaliana |
| Position | chr5: 18384962-18385138 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, circRNA_finder, find_circ, CIRI2 |
| Parent gene | AT5G45360 |
| Parent gene annotation |
F-box protein SKIP31 |
| Parent gene strand | - |
| Alternative splicing | AT5G45360_circ_g.2 AT5G45360_circ_g.3 |
| Support reads | 5/2 |
| Tissues | leaf/root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT5G45360.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.478970763 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
18385089-18384964(-) |
| Potential amino acid sequence |
MVCTISGVCSDTLLVQTEPDADGCYEEEAELEAEVFTDKSRLVCDDNCKEVILSPEGDLMVCTI SGVCSDTLLVQTEPDADGCYEEEAELEAEVFTDKSRLVCDDNCKEVILSPEGDLMVCTISGVCS DTLLVQTEPDADGCYEEEAELEAEVFTDKSRLVCDDNCKEVILSPEGDLMVCTISGVCSDTLLV QTEPDADGCYEEEAELEAEVFTDKSRL(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | response to drought stress |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017;Chen et al., 2017a;Zhang et al., 2019 |