Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0971600_circ_g.3 |
| ID in PlantcircBase | osa_circ_006016 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 42864612-42865418 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, KNIFE, PcircRNA_finder |
| Parent gene | Os01g0971600 |
| Parent gene annotation |
Similar to Sn-glycerol-3-phosphate dehydrogenase (Fragment). (Os 01t0971600-01) |
| Parent gene strand | - |
| Alternative splicing | Os01g0971600_circ_g.4 Os01g0971600_circ_igg.1 |
| Support reads | 1 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-GC |
| Number of exons covered | Os01t0971600-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.191015768 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
42865356-42864625(+) 42865409-42865412(-) |
| Potential amino acid sequence |
MDSESFLPVGNISSNTHILTSSHLQC*(+) MWVFEEILPTGKKLSESINQANENCKYLPGIKLGANVIADPDLENAVKDANMLVFVTPHQFVEG ICKKLVGKLRPGTEGISLIKGMEVKMEGPCMISKLITNILGINCCVLMGANIANEMK*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |