Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.008G264300_circ_g.1 |
| ID in PlantcircBase | gra_circ_000883 |
| Alias | Chr08:54393670|54394107 |
| Organism | Gossypium raimondii |
| Position | chrChr08: 54393670-54394107 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.008G264300 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 3 |
| Tissues | ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Gorai.008G264300.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | gar_circ_000968 |
| PMCS | 0.543074353 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
54393859-54393674(+) 54393683-54394057(-) 54393828-54394106(-) |
| Potential amino acid sequence |
MAGGLGYDVPAGRRDGRTSLASEIIGNLPPPTFNVDQLTQMFANKGFTQEEMVTLSGL*(+) MHHNPERVTISSCVNPLFANI*(-) MSAQETTPLQTISSLAFALSMTSYPRKLGLLAKESFSAVLDGVELRSIDASQP*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |