Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT2G36850_circ_g.23 |
| ID in PlantcircBase | ath_circ_016948 |
| Alias | At_ciR4331 |
| Organism | Arabidpsis thaliana |
| Position | chr2: 15467874-15468212 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | AT2G36850 |
| Parent gene annotation |
Callose synthase 10 |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 3 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT2G36850.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.201352827 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
15468132-15467876(-) |
| Potential amino acid sequence |
MTNAIGVFPEVRGAVQAIRYTEHFPRLPVDFEISGQRDADMFDLLEYIFGFQLGRIKKADATLS AELTPYNIVPLEAQSMTNAIGVFPEVRGAVQAIRYTEHFPRLPVDFEISGQRDADMFDLLEYIF GFQLGRIKKADATLSAELTPYNIVPLEAQSMTNAIGVFPEVRGAVQAIRYTEHFPRLPVDFEIS GQRDADMFDLLEYIFGFQLGRIKKADATLSAELTPYNIVPLEAQSMTNAIGVFPEVRGAVQAIR YTEHFPRLPVDFEISGQRDADMFDLLEYIFGFQ(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |