Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0886300_circ_g.4 |
ID in PlantcircBase | osa_circ_005132 |
Alias | NA |
Organism | Oryza sativa |
Position | chr1: 38510321-38511885 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os01g0886300 |
Parent gene annotation |
K Homology domain containing protein. (Os01t0886300-01);Hypothet ical gene. (Os01t0886300-02);K Homology domain containing protei n. (Os01t0886300-03) |
Parent gene strand | + |
Alternative splicing | Os01g0886300_circ_g.5 Os01g0886300_circ_g.6 Os01g0886300_circ_g.7 |
Support reads | 1 |
Tissues | shoot, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os01t0886300-01:4 Os01t0886300-03:4 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_011025 |
PMCS | 0.223230836 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
38511204-38510329(+) 38510366-38511848(-) |
Potential amino acid sequence |
MDLEGWSGMQTENMRVLQASSMGWNGPPAITGTPVVKKVVRLDVPVDKYPNYNFVGRLLGPRGN SLKRVEASTQCRVYIRGRGSVKDSVKISG*(+) MELISASRQATQPDILTESFTEPRPRI*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |