Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT4G13040_circ_g.6 |
| ID in PlantcircBase | ath_circ_030641 |
| Alias | At_ciR1834, AT4G13040_C1 |
| Organism | Arabidpsis thaliana |
| Position | chr4: 7614768-7615142 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, KNIFE, PcircRNA_finder, find_circ, CIRI-full, CIRI2 |
| Parent gene | AT4G13040 |
| Parent gene annotation |
Integrase-type DNA-binding superfamily protein |
| Parent gene strand | + |
| Alternative splicing | AT4G13040_circ_g.1 AT4G13040_circ_g.2 AT4G13040_circ_g.3 AT4G13040_circ_g.4 AT4G13040_circ_g.5 |
| Support reads | 5/6 |
| Tissues | leaf/aerial, whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT4G13040.6:2 AT4G13040.4:2 AT4G13040.2:2 AT4G13040.1:2 AT4G13040.3:2 AT4G13040.8:2 AT4G13040.7:2 AT4G13040.5:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.434991216 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
7614833-7615139(+) |
| Potential amino acid sequence |
MRGVYYKNMKWQAAIKVEKKQIHLGTFSSQEEAARLYDRAAFMCGREPNFELSEEVIRELKQQS WEEFLNCTRRTITNKNQPPKRRKQHRRKRVHNQEPCLMRGVYYKNMKWQAAIKVEKKQIHLGTF SSQEEAARLYDRAAFMCGREPNFELSEEVIRELKQQSWEEFLNCTRRTITNKNQPPKRRKQHRR KRVHNQEPCLMRGVYYKNMKWQAAIKVEKKQIHLGTFSSQEEAARLYDRAAFMCGREPNFELSE EVIRELKQQSWEEFLNCTRRTITNKNQPPKRRKQHRRKRVHNQEPCLMRGVYYKNMKWQAAIKV EKKQIHLGTFSSQEEAARLYDRAAFMCGREPNFELSEEVIRELKQQSWEEFLNCTRRTITNK(+ ) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | response to drought stress |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017;Zhang et al., 2019 |