Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.001G021800_circ_g.1 |
| ID in PlantcircBase | gra_circ_000015 |
| Alias | Chr01:2051554|2051938 |
| Organism | Gossypium raimondii |
| Position | chrChr01: 2051554-2051938 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.001G021800 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 5 |
| Tissues | ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Gorai.001G021800.1:2 Gorai.001G021800.5:2 Gorai.001G021800.3:2 Gorai.001G021800.2:2 Gorai.001G021800.4:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.466491818 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
2051600-2051603(+) 2051591-2051897(-) |
| Potential amino acid sequence |
MLRGEILTALAMLGHKETLSEASRRFDAFLKDRNTPLLPPDTRKAAYVAVMQTVTSSNRAGFDS LLKVYRETDLSQEKIRILGSSVGMLHKVRVIWIQC*(+) MTLTLCSIPTELPKMRIFSWLKSVSL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |