Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os08g0129700_circ_g.3 |
ID in PlantcircBase | osa_circ_035730 |
Alias | Os_ciR11396 |
Organism | Oryza sativa |
Position | chr8: 1667466-1669955 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os08g0129700 |
Parent gene annotation |
NAD(P)-binding domain containing protein. (Os08t0129700-01);NAD( P)-binding domain containing protein. (Os08t0129700-02) |
Parent gene strand | + |
Alternative splicing | Os08g0129700_circ_g.4 Os08g0129700_circ_g.5 Os08g0129700_circ_g.6 |
Support reads | 2/1 |
Tissues | root/root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os08t0129700-01:5 Os08t0129700-02:5 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.130951928 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
1667588-1667517(+) 1669755-1667521(+) |
Potential amino acid sequence |
MIPLNRRASQTRGGMEYFDARRKPHNVGKVIAALVLTTLCIFILKQSPGFGGSSVFSRHEPGVT HVLVTGGAGYIGSHASLRLLKDNYRVTIVDNLSRGNMGAVKVLQELFPQPGRLQFIYADLGDQK TVNKIFAENAFDAVMHFAAVAYVGESTLEPLSSSSGWTNSIHGRWWWWC*(+) MLILEIKKLSTRSLPKMRLMLLCTLLLLPMWVRVHWNPLVHLLAGRIQFTDGGGGGVD*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |