Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT1G70320_circ_g.12 |
| ID in PlantcircBase | ath_circ_009437 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr1: 26500650-26500856 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | KNIFE, PcircRNA_finder, CIRI-full |
| Parent gene | AT1G70320 |
| Parent gene annotation |
E3 ubiquitin-protein ligase UPL2 |
| Parent gene strand | - |
| Alternative splicing | AT1G70320_circ_g.13 |
| Support reads | 13 |
| Tissues | whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT1G70320.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.253783821 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
26500821-26500853(+) |
| Potential amino acid sequence |
MIEEVHPMMEVTLIRSVKLFVSAVLQNKSDNSENLKNSILWERWIRFIKFFLNTQILPYFYVLL KKSVKMIEEVHPMMEVTLIRSVKLFVSAVLQNKSDNSENLKNSILWERWIRFIKFFLNTQILPY FYVLLKKSVKMIEEVHPMMEVTLIRSVKLFVSAVLQNKSDNSENLKNSILWERWIRFIKFFLNT QILPYFYVLLKKSVKMIEEVHPMMEVT(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |