Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os09g0491740_circ_g.5 |
| ID in PlantcircBase | osa_circ_039671 |
| Alias | Os09circ08029 |
| Organism | Oryza sativa |
| Position | chr9: 18981682-18981859 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | SMALT, Segemehl |
| Parent gene | Os09g0491740 |
| Parent gene annotation |
Auxin efflux carrier domain containing protein. (Os09t0491740-01 ) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | panicle |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os09t0491740-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.145597378 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
18981818-18981847(-) |
| Potential amino acid sequence |
MGLLELFITACVPVLNMLLVTGVGSFLATDFVGILNKDARKYLNNDREQ*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015 |