Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os09g0555700_circ_g.2 |
ID in PlantcircBase | osa_circ_040164 |
Alias | NA |
Organism | Oryza sativa |
Position | chr9: 22069258-22070134 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os09g0555700 |
Parent gene annotation |
Zinc finger, C2H2-type domain containing protein. (Os09t0555700- 01);Zinc finger, C2H2-type domain containing protein. (Os09t0555 700-02);Zinc finger, C2H2-type domain containing protein. (Os09t 0555700-03) |
Parent gene strand | - |
Alternative splicing | Os09g0555700_circ_g.3 |
Support reads | 6 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os09t0555700-02:2 Os09t0555700-03:2 Os09t0555700-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_008227* osi_circ_018758 |
PMCS | 0.478093396 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
22070088-22069341(+) 22069919-22070103(-) |
Potential amino acid sequence |
MAGTVYLSASPPAASDLEKRVPQSQRYSRVPQVLEWAFQSDCTA*(+) MAAASSAPFFGLGDTQMPPPQNPTNPALHHHPNPSPAPVAAAAPAPKKKRNQPGNPNPDAEVIA LSPRTLMATNRFVCEVCNKGFQREQNLQLHRRGHNLPWKLKQKNPKEARRRVYLCPEPSCVHHD PSRALGDLTGIKKHYCRKHGEKKWRCDKCSKRYAVQSDWKAHSKTCGTREYRCDCGTLFSRSEA AGGEADR*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |