Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT5G47820_circ_g.7 |
ID in PlantcircBase | ath_circ_042970 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr5: 19370041-19370296 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | AT5G47820 |
Parent gene annotation |
Kinesin-like protein KIN-4A |
Parent gene strand | + |
Alternative splicing | AT5G47820_circ_g.8 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT5G47820.2:2 AT5G47820.1:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.292530046 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
19370059-19370293(+) |
Potential amino acid sequence |
MKQEAEQFRQWKASREKELLQLRKEGRKSEYERHKLQALNQRQKMVQLQHRMKQEAEQFRQWKA SREKELLQLRKEGRKSEYERHKLQALNQRQKMVQLQHRMKQEAEQFRQWKASREKELLQLRKEG RKSEYERHKLQALNQRQKMVQLQHRMKQEAEQFRQWKASREKELLQLRKEGRKSEYERHKLQAL NQRQKM(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |