Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0724900_circ_g.4 |
| ID in PlantcircBase | osa_circ_032416 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr6: 30818032-30820304 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os06g0724900 |
| Parent gene annotation |
Raf-Like MAPKKK, Mechanical tissue formation at the leaf lamina joint (Os06t0724900-01) |
| Parent gene strand | + |
| Alternative splicing | Os06g0724900_circ_g.5 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os06t0724900-01:6 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.094605191 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
30819327-30818072(+) 30818040-30818052(+) 30818109-30819315(-) |
| Potential amino acid sequence |
MGSQGNPTSRRSVGEGNSQLRTTVMPWMSMLRGQKTF*(+) MDVNVERAEDVLMHMKLLEKAIHPENQPAFSVRIVQVPLDIDASEADSQSNITEDDNCPTPRTP AEHPAPIFGSTTALKALVRQASSKNLLDDNQDIDAILRPMHEITFASDDKPKGLTQLSSLLGNL NLDIKEVHALSTNDGYFLDIFIVIGWDHKETQLLEEALEKEIHNYEPQLCHGCQC*(+) MDSLLKQLHVHQNVFCPLNIDIHGITVVRNCEFPSPTLLREVGFPCDPIRLR*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |