Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d032956_circ_g.2 |
ID in PlantcircBase | zma_circ_006844 |
Alias | zma_circ_0000462, GRMZM2G040326_C1 |
Organism | Zea mays |
Position | chr1: 244609349-244609938 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | find_circ, CIRI2 |
Parent gene | Zm00001d032956 |
Parent gene annotation |
Acylamino-acid-releasing enzyme |
Parent gene strand | - |
Alternative splicing | Zm00001d032956_circ_g.1 |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d032956_T018:3 Zm00001d032956_T005:3 Zm00001d032956_T003:3 Zm00001d032956_T014:3 Zm00001d032956_T013:3 Zm00001d032956_T008:3 Zm00001d032956_T015:3 Zm00001d032956_T001:3 Zm00001d032956_T016:3 Zm00001d032956_T010:3 Zm00001d032956_T020:3 Zm00001d032956_T006:3 Zm00001d032956_T011:3 Zm00001d032956_T002:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.132966984 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
244609863-244609566(+) |
Potential amino acid sequence |
MKNNDCWITCRILMRHKNSLKRKLSPWPIKCVVRKPPCEPPTTATLDGSISPLFITRSNAVNTS LTS*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | responsive to drought stress |
Other Information | |
---|---|
References | Ma et al., 2021b;Zhang et al., 2019 |