Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d032956_circ_g.2 |
| ID in PlantcircBase | zma_circ_006844 |
| Alias | zma_circ_0000462, GRMZM2G040326_C1 |
| Organism | Zea mays |
| Position | chr1: 244609349-244609938 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | u-circRNA |
| Identification method | find_circ, CIRI2 |
| Parent gene | Zm00001d032956 |
| Parent gene annotation |
Acylamino-acid-releasing enzyme |
| Parent gene strand | - |
| Alternative splicing | Zm00001d032956_circ_g.1 |
| Support reads | NA |
| Tissues | leaf, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Zm00001d032956_T018:3 Zm00001d032956_T005:3 Zm00001d032956_T003:3 Zm00001d032956_T014:3 Zm00001d032956_T013:3 Zm00001d032956_T008:3 Zm00001d032956_T015:3 Zm00001d032956_T001:3 Zm00001d032956_T016:3 Zm00001d032956_T010:3 Zm00001d032956_T020:3 Zm00001d032956_T006:3 Zm00001d032956_T011:3 Zm00001d032956_T002:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.132966984 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
244609863-244609566(+) |
| Potential amino acid sequence |
MKNNDCWITCRILMRHKNSLKRKLSPWPIKCVVRKPPCEPPTTATLDGSISPLFITRSNAVNTS LTS*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | responsive to drought stress |
| Other Information | |
|---|---|
| References | Ma et al., 2021b;Zhang et al., 2019 |