Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d037794_circ_g.2 |
| ID in PlantcircBase | zma_circ_009063 |
| Alias | Zm06circ00064, zma_circ_0002224, GRMZM2G088501_C1 |
| Organism | Zea mays |
| Position | chr6: 137929093-137929481 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | e-circRNA |
| Identification method | CIRI2, find_circ |
| Parent gene | Zm00001d037794 |
| Parent gene annotation |
Sec14p-like phosphatidylinositol transfer family protein |
| Parent gene strand | - |
| Alternative splicing | Zm00001d037794_circ_g.1 |
| Support reads | NA |
| Tissues | leaf, endosperm, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Zm00001d037794_T001:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.175766108 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
137929441-137929095(-) |
| Potential amino acid sequence |
MPNFLSDATIRRFLRARNWSTMKATKSLKEATSWRRQYKPEKIRWESIADSENEARRAYIPDYL DKKGRMVFVTLPTIKVNEVRELLGDLPTEMPNFLSDATIRRFLRARNWSTMKATKSLKEATSWR RQYKPEKIRWESIADSENEARRAYIPDYLDKKGRMVFVTLPTIKVNEVRELLGDLPTEMPNFLS DATIRRFLRARNWSTMKATKSLKEATSWRRQYKPEKIRWESIADSENEARRAYIPDYLDKKGRM VFVTLPTIKVNEVRELLGDLPTEMPNFLSDATIRRFLRARNWSTMKATKSLKEATSWRRQYKPE KIRWESIADSENEARRAYIPDYLDKKGRMVFVTLPTIK(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | responsive to drought stress |
| Other Information | |
|---|---|
| References | Han et al., 2020; Ma et al., 2021b;Zhang et al., 2019 |