Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d037794_circ_g.2 |
ID in PlantcircBase | zma_circ_009063 |
Alias | Zm06circ00064, zma_circ_0002224, GRMZM2G088501_C1 |
Organism | Zea mays |
Position | chr6: 137929093-137929481 JBrowse» |
Reference genome | AGPv4.38 |
Type | e-circRNA |
Identification method | CIRI2, find_circ |
Parent gene | Zm00001d037794 |
Parent gene annotation |
Sec14p-like phosphatidylinositol transfer family protein |
Parent gene strand | - |
Alternative splicing | Zm00001d037794_circ_g.1 |
Support reads | NA |
Tissues | leaf, endosperm, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d037794_T001:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.175766108 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
137929441-137929095(-) |
Potential amino acid sequence |
MPNFLSDATIRRFLRARNWSTMKATKSLKEATSWRRQYKPEKIRWESIADSENEARRAYIPDYL DKKGRMVFVTLPTIKVNEVRELLGDLPTEMPNFLSDATIRRFLRARNWSTMKATKSLKEATSWR RQYKPEKIRWESIADSENEARRAYIPDYLDKKGRMVFVTLPTIKVNEVRELLGDLPTEMPNFLS DATIRRFLRARNWSTMKATKSLKEATSWRRQYKPEKIRWESIADSENEARRAYIPDYLDKKGRM VFVTLPTIKVNEVRELLGDLPTEMPNFLSDATIRRFLRARNWSTMKATKSLKEATSWRRQYKPE KIRWESIADSENEARRAYIPDYLDKKGRMVFVTLPTIK(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | responsive to drought stress |
Other Information | |
---|---|
References | Han et al., 2020; Ma et al., 2021b;Zhang et al., 2019 |