Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0702000_circ_g.4 |
| ID in PlantcircBase | osa_circ_003535 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 29075712-29076025 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os01g0702000 |
| Parent gene annotation |
Protein of unknown function DUF151 domain containing protein. (O s01t0702000-01) |
| Parent gene strand | - |
| Alternative splicing | Os01g0702000_circ_g.2 Os01g0702000_circ_g.3 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0702000-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_002336* |
| PMCS | 0.146027574 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
29075840-29075758(+) 29076026-29075966(-) |
| Potential amino acid sequence |
MPLGRETEEPARRPVVVSLQPTGSSPQVHAPKQLPADLRVGGQGAGRRSSIARENRPVDDLHPA SITLELTNSSPLAS*(+) MEIINGPVLPRYAAPATGALTSDAKISGQLLRRVHLRRRACGLQGDHYRAARRFFGFPSERHAR SGWVWPVCCSYGSSSDGDGAAAADYDASGEEFVNSSVMEAGWRSSTGRFSRAMLLRRPAP*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |