Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0702000_circ_g.4 |
ID in PlantcircBase | osa_circ_003535 |
Alias | NA |
Organism | Oryza sativa |
Position | chr1: 29075712-29076025 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os01g0702000 |
Parent gene annotation |
Protein of unknown function DUF151 domain containing protein. (O s01t0702000-01) |
Parent gene strand | - |
Alternative splicing | Os01g0702000_circ_g.2 Os01g0702000_circ_g.3 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os01t0702000-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_002336* |
PMCS | 0.146027574 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
29075840-29075758(+) 29076026-29075966(-) |
Potential amino acid sequence |
MPLGRETEEPARRPVVVSLQPTGSSPQVHAPKQLPADLRVGGQGAGRRSSIARENRPVDDLHPA SITLELTNSSPLAS*(+) MEIINGPVLPRYAAPATGALTSDAKISGQLLRRVHLRRRACGLQGDHYRAARRFFGFPSERHAR SGWVWPVCCSYGSSSDGDGAAAADYDASGEEFVNSSVMEAGWRSSTGRFSRAMLLRRPAP*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |