Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os10g0177400_circ_g.1 |
| ID in PlantcircBase | osa_circ_006320 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr10: 5345588-5345977 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os10g0177400 |
| Parent gene annotation |
TB2/DP1 and HVA22 related protein family protein. (Os10t0177400- 01);Similar to TB2/DP1, HVA22 family protein, expressed. (Os10t0 177400-02) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os10t0177400-01:3 Os10t0177400-02:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.283458996 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
5345739-5345930(-) 5345625-5345947(-) |
| Potential amino acid sequence |
MATTVLRSKADVLYILMVPKDKGWPLVMLILLMNAIKP*(-) MFFIYLWCPRTKVGLWLCLSCL*(-) |
| Sponge-miRNAs | osa-miR1320-3p |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |