Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT4G33530_circ_g.1 |
| ID in PlantcircBase | ath_circ_034426 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr4: 16127906-16128160 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder |
| Parent gene | AT4G33530 |
| Parent gene annotation |
Potassium transporter 13 |
| Parent gene strand | - |
| Alternative splicing | AT4G33530_circ_g.2 AT4G33530_circ_g.3 AT4G33530_circ_g.4 |
| Support reads | 18 |
| Tissues | whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT4G33530.1:1 AT4G33530.2:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.38054267 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
16128099-16127908(-) |
| Potential amino acid sequence |
MTTATFTCIKQSIALGCFPRLKIIHTSKKFIGQIYIPVLNWSLLVVCLIVVCSTSNIFAIGNAY GSLFWPVFLISNVAALIASRAMTTATFTCIKQSIALGCFPRLKIIHTSKKFIGQIYIPVLNWSL LVVCLIVVCSTSNIFAIGNAYGSLFWPVFLISNVAALIASRAMTTATFTCIKQSIALGCFPRLK IIHTSKKFIGQIYIPVLNWSLLVVCLIVVCSTSNIFAIGNAYGSLFWPVFLISNVAALIASRAM TTATFTCIKQSIALGCFPRLKIIHTSKKFIGQIYIPVLNWSLLVVCLIVVCSTSNIFAIGNAY( -) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |