Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0161000_circ_g.9 |
| ID in PlantcircBase | osa_circ_032849 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr7: 3272975-3273751 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os07g0161000 |
| Parent gene annotation |
Tetratricopeptide-like helical domain containing protein. (Os07t 0161000-01);Hypothetical conserved gene. (Os07t0161000-02) |
| Parent gene strand | - |
| Alternative splicing | Os07g0161000_circ_g.6 Os07g0161000_circ_g.7 Os07g0161000_circ_g.8 Os07g0161000_circ_g.10 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os07t0161000-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.130433752 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
3273725-3273144(+) 3273681-3273738(-) |
| Potential amino acid sequence |
MVCSLSYPWPQNCSNSFIIWGKFMCFTQVTHRRFQVS*(+) MACYLKTRNFEECINEGSEVLTYDSSNVKAYYRRGQAYKELGNLEAAVGDLSKAHELSPDDETI AAVLRPRIT*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |