Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.012G100600_circ_g.1 |
| ID in PlantcircBase | gra_circ_001329 |
| Alias | Chr12:21985874|21986863 |
| Organism | Gossypium raimondii |
| Position | chrChr12: 21985874-21986863 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.012G100600 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 4 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Gorai.012G100600.5:2 Gorai.012G100600.4:2 Gorai.012G100600.1:2 Gorai.012G100600.2:2 Gorai.012G100600.6:1 Gorai.012G100600.3:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.149748173 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
21986815-21986039(-) 21986855-21985969(+) |
| Potential amino acid sequence |
MGKRVVFLKQLTSGLLLVTGPFKINGVPLRRLNQSYVIATSTKVDISGVNVEKFDDKYFAKEVE KKKKGEGEFFEAEKESKHYSRDSLDFVGWKIYGEESCFLEATYFWASFGYWTIQD*(-) MLALFFSFEKLSFTLLLFFYFLGKVLVIKLLYINS*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |