Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Csa3G827340_circ_g.1 |
| ID in PlantcircBase | csa_circ_002084 |
| Alias | Chr3:32963834_32964988 |
| Organism | Cucumis sativus |
| Position | chrChr3: 32963834-32964988 JBrowse» |
| Reference genome | Cucumis sativus v1.5 |
| Type | e-circRNA |
| Identification method | CIRI2 |
| Parent gene | Csa3G827340 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | leaf,root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Csa3G827340.1:6 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.168934084 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
32963840-32963884(+) |
| Potential amino acid sequence |
MLTFLVGSKQAFEVSLADVAQTQLQGKNDVMLEFHVDDTTGANEKDSLMEISFHIPNTNTQFVG DESRPPAQVFRDKIMSMADVSAGIEEAVVTFEGIAILTPRGRYSVELHLSFLRLQGQANDFKIQ YSSVVRLFLLPKSNQPHTFVVVTLDPPIRKGQTLYPHIVLQFETDYVVQSTLQIGDELFNTKYK DKLEPSYKGICLLSWLVRSKHLKCL* |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | responsive to salt stress in root |
| Other Information | |
|---|---|
| References | Zhu et al., 2019 |