Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os05g0574700_circ_g.1 |
ID in PlantcircBase | osa_circ_029061 |
Alias | NA |
Organism | Oryza sativa |
Position | chr5: 28629899-28630618 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os05g0574700 |
Parent gene annotation |
Similar to cDNA clone:002-182-C01, full insert sequence. (Os05t0 574700-01);Similar to predicted protein. (Os05t0574700-02) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os05t0574700-01:5 Os05t0574700-02:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_015805 |
PMCS | 0.181386412 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
28630412-28630492(-) |
Potential amino acid sequence |
MYRFAGFDPFERSTYFGRQFDLGQFERFRRIFHHSTYRVLLAHKERTILSSLWVEENLYKQRVW VRGSRPEEEAIFQFTMVQARNTEEKAFRPQVEF*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |