Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0452900_circ_g.3 |
| ID in PlantcircBase | osa_circ_028107 |
| Alias | Os_ciR9950 |
| Organism | Oryza sativa |
| Position | chr5: 22216386-22216704 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os05g0452900 |
| Parent gene annotation |
Similar to phosphatidic acid phosphatase-related / PAP2-related. (Os05t0452900-01);Similar to Phosphatidic acid phosphatase-like protein. (Os05t0452900-02) |
| Parent gene strand | - |
| Alternative splicing | Os05g0452900_circ_g.1 Os05g0452900_circ_g.2 |
| Support reads | 2/2 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os05t0452900-01:2 Os05t0452900-02:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.287955852 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
22216661-22216409(+) 22216403-22216676(-) 22216656-22216676(-) |
| Potential amino acid sequence |
MKISDHRSQKVLHEEQATTTSTE*(+) MLLLLVPRGVLFGCGDLIFSSHMIFTLVFVRTYHKYGSKRFVKLLAWFMAIVQSLLIIASRKHY SVDVVVACSSWSTFWLR*(-) MIFTLVFVRTYHKYGSKRFVKLLAWFMAIVQSLLIIASRKHYSVDVVVACSSWSTFWLR*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |