Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT3G16950_circ_g.5 |
| ID in PlantcircBase | ath_circ_022322 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr3: 5788565-5788869 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder |
| Parent gene | AT3G16950 |
| Parent gene annotation |
Dihydrolipoyl dehydrogenase 1, chloroplastic |
| Parent gene strand | - |
| Alternative splicing | AT3G16950_circ_g.6 AT3G16950_circ_g.7 |
| Support reads | 2 |
| Tissues | whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT3G16950.2:2 AT3G16950.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.30752735 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
5788840-5788567(-) |
| Potential amino acid sequence |
MPGFDPEISKLAQRVLINPRKIDYHTGVFASKITPARDGKPVLIELIDAKTKEPKDTLEVTFIE ALDQLMPGFDPEISKLAQRVLINPRKIDYHTGVFASKITPARDGKPVLIELIDAKTKEPKDTLE VTFIEALDQLMPGFDPEISKLAQRVLINPRKIDYHTGVFASKITPARDGKPVLIELIDAKTKEP KDTLEVTFIEALDQLMPGFDPEISKLAQRVLINPRKIDYHTGVFASKITPARDGKPVLIELIDA KTKEPKDTLE(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |