Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0410100_circ_g.1 |
| ID in PlantcircBase | osa_circ_020291 |
| Alias | Os_ciR4722 |
| Organism | Oryza sativa |
| Position | chr3: 16890089-16892246 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | find_circ |
| Parent gene | Os03g0410100 |
| Parent gene annotation |
Similar to cDNA clone:J033024M21, full insert sequence. (Os03t04 10100-01) |
| Parent gene strand | + |
| Alternative splicing | Os03g0410100_circ_g.2 |
| Support reads | 4 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os03t0410100-01:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.104519053 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
16892207-16890113(+) 16890095-16892152(-) |
| Potential amino acid sequence |
MSFLVHTLLGILSRSLICTLNC*(+) MTLTKCPRVCEQERTSFQSALNLSISFAVRFLK*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |