Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | BGIOSGA003919_circ_g.1 |
ID in PlantcircBase | osi_circ_002190 |
Alias | 1:26279011|26279969 |
Organism | Oryza sativa ssp. indica |
Position | chr1: 26279011-26279969 JBrowse» |
Reference genome | Oryza_indica.ASM465v1.42 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | BGIOSGA003919 |
Parent gene annotation | NA |
Parent gene strand | + |
Alternative splicing | BGIOSGA003919_circ_g.2 BGIOSGA003919_circ_g.3 |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | BGIOSGA003919-TA:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
26279855-26279038(+) 26279836-26279028(+) |
Potential amino acid sequence |
MHLQMVDLLAVMLVVRAHISQMVAFQNLLDSIRFACLWCGHHIGNRIQ*(+) MNLSPSNASANGRPAGSNASGSSAYLPNGGISKPVGLNSLRLPVVWTSYRQ*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Huang et al., 2021 |