Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | BGIOSGA019176_circ_g.1 |
ID in PlantcircBase | osi_circ_005967 |
Alias | 5:3025259|3025939 |
Organism | Oryza sativa ssp. indica |
Position | chr5: 3025259-3025939 JBrowse» |
Reference genome | Oryza_indica.ASM465v1.42 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | BGIOSGA019176 |
Parent gene annotation | NA |
Parent gene strand | + |
Alternative splicing | BGIOSGA019176_circ_igg.1 BGIOSGA019176_circ_igg.2 BGIOSGA019176_circ_igg.3 BGIOSGA019176_circ_igg.4 |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | BGIOSGA019176-TA:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
3025276-3025746(-) 3025927-3025264(+) |
Potential amino acid sequence |
MFFKIPPKHHRSNADLLLSSSLTEPVPLIFSQNG*(-) MVLWRDFEEHSRGASQFSDNQVAAKKKSVKSSQGLAEACKFVYNDAKFVNERAQNDILLLSRGI TRLNKRACQDVAVLGSGFLKLDARARKDTKKIDHSVKERAARLTHFARILKEQAQSDLKKAADQ HWSDGALEGF*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Huang et al., 2021 |