Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0865600_circ_g.3 |
ID in PlantcircBase | osa_circ_004945 |
Alias | NA |
Organism | Oryza sativa |
Position | chr1: 37458163-37459085 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os01g0865600 |
Parent gene annotation |
Basic helix-loop-helix dimerisation region bHLH domain containin g protein. (Os01t0865600-01);Basic helix-loop-helix dimerisation region bHLH domain containing protein. (Os01t0865600-02) |
Parent gene strand | + |
Alternative splicing | Os01g0865600_circ_g.1 Os01g0865600_circ_g.2 Os01g0865600_circ_g.4 Os01g0865600_circ_g.5 Os01g0865600_circ_g.6 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os01t0865600-01:4 Os01t0865600-02:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.109485175 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
37458234-37458189(+) 37458541-37459062(-) |
Potential amino acid sequence |
MDLLLKEKAAALRSGTGRGGGGGEGHAADGAAGHSHDRVDALVHKAMAQQVHVVGEGVIGQAAL TGLHRWIVHDIVDECEEEDEVLLEMKGQFCAGIQTIAVIPVLPRGVIQLGSTKMEIGVGGWAL* (+) MQPCQCSLTNHPFSHDVDLLRHGLVHERVHPVMAVSRGAISRVPLAAATTAPGAAPQRRGLLLE QQVHGLEAGDRRRSGRPLIVPIPPHQFPFLWSQAE*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |