Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Cotton_A_05690_circ_g.1 |
| ID in PlantcircBase | gar_circ_000005 |
| Alias | CA_chr1_BGI-A2_v1.0:2165369|2165956 |
| Organism | Gossypium arboreum |
| Position | chrCA_chr1_BGI-A2_v1.0: 2165369-2165956 JBrowse» |
| Reference genome | BGI-A2_v1.0 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Cotton_A_05690 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 3/9 |
| Tissues | leaf/ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Cotton_A_05690:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | gra_circ_000012* |
| PMCS |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
2165735-2165371(+) |
| Potential amino acid sequence |
MDLKIVRAKDIPLDRVLARQEIDLLTAQAWLSENKQLEQKI*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |