Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.004G221700_circ_g.1 |
| ID in PlantcircBase | gra_circ_000391 |
| Alias | Chr04:55632875|55633491 |
| Organism | Gossypium raimondii |
| Position | chrChr04: 55632875-55633491 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.004G221700 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 5/20 |
| Tissues | leaf/ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Gorai.004G221700.1:4 Gorai.004G221700.2:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | gar_circ_000528 |
| PMCS | 0.183790262 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
55632935-55633425(-) 55632886-55633235(-) |
| Potential amino acid sequence |
MFMSLKIPILLSKTIVDDIYLYRSRYLLFSNPIIFLLFCTRF*(-) MIYTSIGVDTFFSVILSYFCFFVPVFNPCQGRLPLRKYKST*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |