Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os10g0140200_circ_g.6 |
| ID in PlantcircBase | osa_circ_006175 |
| Alias | Os_ciR3293 |
| Organism | Oryza sativa |
| Position | chr10: 2483858-2485949 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os10g0140200 |
| Parent gene annotation |
Glycoside hydrolase, family 38 domain containing protein. (Os10t 0140200-01) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 3/2 |
| Tissues | root/shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os10t0140200-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.099573944 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
2483870-2483911(+) |
| Potential amino acid sequence |
MGYVSTMVSPSNDTIEIGPGPLKMSYSSKSGQLKRMFNSISAVDLPIQQSFLWYASSTGDSEDS QASGAYIFRPNRTTPTIVSGMDLMEWGMSQPWFLQVMTQ*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |