Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT3G05760_circ_g.2 |
ID in PlantcircBase | ath_circ_019941 |
Alias | At_ciR4760 |
Organism | Arabidpsis thaliana |
Position | chr3: 1709215-1709426 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | find_circ, CIRI-full |
Parent gene | AT3G05760 |
Parent gene annotation |
AT3g05760/F10A16_5 |
Parent gene strand | + |
Alternative splicing | AT3G05760_circ_g.1 |
Support reads | 2 |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT3G05760.2:2 AT3G05760.1:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.166667768 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
1709232-1709423(+) |
Potential amino acid sequence |
MSMRVERSSLEQVQERFEVLKKRKAPGTFTEQDQRALGMSMRVERSSLEQVQERFEVLKKRKAP GTFTEQDQRALGMSMRVERSSLEQVQERFEVLKKRKAPGTFTEQDQRALGMSMRVERSSLEQVQ ERFEVLKKRKAPGTFTEQ(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |