Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.001G050200_circ_g.1 |
| ID in PlantcircBase | gra_circ_000027 |
| Alias | Chr01:4765038|4765360 |
| Organism | Gossypium raimondii |
| Position | chrChr01: 4765038-4765360 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.001G050200 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Gorai.001G050200.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | gar_circ_000036* |
| PMCS | 0.583350929 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
4765052-4765043(+) |
| Potential amino acid sequence |
MEPFLKKFFPKVYTKMKEDTKISNYCKFDSQLLTSFTSSLYIAGLISSFLASPVTGAFGRKPSI LIGGAAFLAGSALGGAAVNVYMLILGRVLLGVGVGFANQVE*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |