Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0819900_circ_g.3 |
| ID in PlantcircBase | osa_circ_022470 |
| Alias | Os_ciR2980 |
| Organism | Oryza sativa |
| Position | chr3: 34409326-34410040 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os03g0819900 |
| Parent gene annotation |
Similar to RAB8C. (Os03t0819900-01) |
| Parent gene strand | + |
| Alternative splicing | Os03g0819900_circ_g.1 Os03g0819900_circ_g.2 |
| Support reads | 4/1 |
| Tissues | root/shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os03t0819900-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.196338205 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
34409407-34409328(+) 34409362-34410005(-) 34409352-34410005(-) |
| Potential amino acid sequence |
MDESKRAVPTSKGQALADEYGIKFFETSAKTNLNVEQVFFSIARDIKQRLSETDSKPET*(+) MLFDVSDPISYVSGLESVSESLCLISLAIEKKTCSTFRFVFALVSKNLIPYSSARACPFEVGTA LLLSSISALFPTKILFTLSEACCSMFLIQFLMSQAWNQSLRVFV*(-) MFLIQFLMSQAWNQSLRVFV*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |