Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0400400_circ_g.2 |
| ID in PlantcircBase | osa_circ_027803 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr5: 19477988-19478035 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os05g0400400 |
| Parent gene annotation |
Similar to Ubiquinol-cytochrome c reductase complex 8.0 kDa prot ein (EC 1.10.2.2). (Os05t0400400-01) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 6 |
| Tissues | pistil |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os05t0400400-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.156246528 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
19478004-19477990(-) |
| Potential amino acid sequence |
MNNIGAVDYGVHKVWEMNNIGAVDYGVHKVWEMNNIGAVDYGVHKVWEMNNIG(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |