Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0837100_circ_g.4 |
| ID in PlantcircBase | osa_circ_022622 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 35179432-35180348 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os03g0837100 |
| Parent gene annotation |
Similar to Cellulose synthase-6. (Os03t0837100-01);Similar to cD NA clone:J023086F23, full insert sequence. (Os03t0837100-02);Sim ilar to cDNA clone:J023086F23, full insert sequence. (Os03t08371 00-03) |
| Parent gene strand | + |
| Alternative splicing | Os03g0837100_circ_g.1 Os03g0837100_circ_g.2 Os03g0837100_circ_g.3 Os03g0837100_circ_g.5 Os03g0837100_circ_g.6 |
| Support reads | 3 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os03t0837100-02:2 Os03t0837100-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.401989395 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
35179434-35179437(+) |
| Potential amino acid sequence |
MDEARQPLSRKIPISSSLVNPYRMIIIIRLVVLGFFFHYRVMHPVPDAFALWLISVICEIWFAM SWILDQFPKWFPIERETYLDRLTLRFDKEGQQSQLAPVDFFVSTVDPMKEPPLVTANTVLSILA VDYPVDKVSCYVSDDGAAMLTFEALSETSEFAKKWVPFCKRYSLEPRAPEWYFQQKIDYLKDKV APNFVRERRAMKREYEEFKVRINALVAKAQKVPEEGWTMQDGTPWPGNNVRDHPGMIQNG*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |