Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0837100_circ_g.4 |
ID in PlantcircBase | osa_circ_022622 |
Alias | NA |
Organism | Oryza sativa |
Position | chr3: 35179432-35180348 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os03g0837100 |
Parent gene annotation |
Similar to Cellulose synthase-6. (Os03t0837100-01);Similar to cD NA clone:J023086F23, full insert sequence. (Os03t0837100-02);Sim ilar to cDNA clone:J023086F23, full insert sequence. (Os03t08371 00-03) |
Parent gene strand | + |
Alternative splicing | Os03g0837100_circ_g.1 Os03g0837100_circ_g.2 Os03g0837100_circ_g.3 Os03g0837100_circ_g.5 Os03g0837100_circ_g.6 |
Support reads | 3 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os03t0837100-02:2 Os03t0837100-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.401989395 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
35179434-35179437(+) |
Potential amino acid sequence |
MDEARQPLSRKIPISSSLVNPYRMIIIIRLVVLGFFFHYRVMHPVPDAFALWLISVICEIWFAM SWILDQFPKWFPIERETYLDRLTLRFDKEGQQSQLAPVDFFVSTVDPMKEPPLVTANTVLSILA VDYPVDKVSCYVSDDGAAMLTFEALSETSEFAKKWVPFCKRYSLEPRAPEWYFQQKIDYLKDKV APNFVRERRAMKREYEEFKVRINALVAKAQKVPEEGWTMQDGTPWPGNNVRDHPGMIQNG*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |