Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT4G17170_circ_g.3 |
ID in PlantcircBase | ath_circ_031419 |
Alias | AT4G17170_C1, AT4G17170_C1 |
Organism | Arabidpsis thaliana |
Position | chr4: 9645581-9645978 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRI2 |
Parent gene | AT4G17170 |
Parent gene annotation |
RABB1C |
Parent gene strand | - |
Alternative splicing | 4_circ_ag.9 AT4G17170_circ_g.1 AT4G17170_circ_g.2 |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT4G17170.1:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.390657874 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
9645595-9645920(-) 9645888-9645920(-) |
Potential amino acid sequence |
MISQGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDNKPIKLQIWDTAGQESFRSITRSY YRGAAGALLVYDITRSGEIMSSASVHRQEVSAGA* MITIDNKPIKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRSGEIMSSASVHRQEVSAGA* |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | response to drought stress |
Other Information | |
---|---|
References | Zhang et al., 2019 |