Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0832600_circ_g.2 |
| ID in PlantcircBase | osa_circ_004702 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 35639358-35639691 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os01g0832600 |
| Parent gene annotation |
Similar to Leucoanthocyanidin dioxygenase-like protein. (Os01t08 32600-01) |
| Parent gene strand | + |
| Alternative splicing | Os01g0832600_circ_g.1 |
| Support reads | 3 |
| Tissues | pistil |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0832600-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.29052248 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
35639411-35639621(+) |
| Potential amino acid sequence |
MRLLSASLGLDETRFQEAFGGADCGAGLRANYYPRCPQPDLTLGLSAHSDPGILTVLLADDHVR GLQVRRRDGHWVTVQPLPDAFIVNVGDQIEGGVRGVRERGDQAVRAADEVAVSEPGAGRDAVPG GVRWGGLRRGPARQLLPAVPAAGPHAGPLRPLRSRHPHRPPRRRPRSRPPGTPP*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |