Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | BGIOSGA004534_circ_g.3 |
| ID in PlantcircBase | osi_circ_002436 |
| Alias | 1:35924029|35927934 |
| Organism | Oryza sativa ssp. indica |
| Position | chr1: 35924029-35927934 JBrowse» |
| Reference genome | Oryza_indica.ASM465v1.42 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | BGIOSGA004534 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | BGIOSGA004534_circ_g.2 BGIOSGA004534_circ_g.4 |
| Support reads | NA |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | BGIOSGA004534-TA:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osa_circ_004117* |
| PMCS |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
35924813-35924030(+) |
| Potential amino acid sequence |
MLVKVTRLDLPLWHQILVLEILRGFCIEAHTLRLLFQTFDMNPTNTNVVENIVRALALVVATIQ ASDLSEETLAAVAGMFSSKAKA*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Huang et al., 2021 |