Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Solyc10g074700.1_circ_g.2 |
ID in PlantcircBase | sly_circ_003146 |
Alias | 10:57633287|57639245 |
Organism | Solanum lycopersicum |
Position | chr10: 58308755-58314713 JBrowse» |
Reference genome | SL2.50.38 |
Type | e-circRNA |
Identification method | CIRI |
Parent gene | Solyc10g074700.1 |
Parent gene annotation |
Ethanolamine-phosphate cytidylyltransferase |
Parent gene strand | + |
Alternative splicing | Solyc10g074700.1_circ_g.1 |
Support reads | 4 |
Tissues | fruit |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Solyc10g074700.1.1:5 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.763707932 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
58308757-58308787(+) |
Potential amino acid sequence |
MIMVGAVKWVDEVISDAPYAITEEFMRKLFDEYNIDYIIHGDDPCLLPDGTDAYALAKKVGRYK QIKRTEGVSSTDIVGRMLLCVRERTTVDSPSHASLQRQFSHGHSQKSDDGGAGSDTRVSHFLPT SRRIVQFSNSKGAGPDARIVYIDGAFDLFHAGHVEILRLARGLGDFLLVGIHTDQTVSANRGGH RPIMNLHERSLSVLACRYADEVIIGAPGEVSKDMDDYGWCCEVGG*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Yin et al., 2018 |