Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT2G38710_circ_g.2 |
| ID in PlantcircBase | ath_circ_017274 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr2: 16186115-16186234 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | AT2G38710 |
| Parent gene annotation |
Uncharacterized protein At2g38710 |
| Parent gene strand | - |
| Alternative splicing | AT2G38710_circ_g.1 AT2G38710_circ_g.3 AT2G38710_circ_g.4 AT2G38710_circ_g.5 AT2G38710_circ_g.6 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT2G38710.1:1 AT2G38710.2:1 AT2G38710.4:1 AT2G38710.3:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.207636739 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
16186178-16186117(-) |
| Potential amino acid sequence |
MYWYTGSTPLDQWLQGLCLDKSIVCYLEENSEWWRASVAWMYWYTGSTPLDQWLQGLCLDKSIV CYLEENSEWWRASVAWMYWYTGSTPLDQWLQGLCLDKSIVCYLEENSEWWRASVAWMYWYTGST PLDQWLQGLCLDK(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |