Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0408100_circ_g.2 |
| ID in PlantcircBase | osa_circ_042546 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr7: 12678844-12678971 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRI-long |
| Parent gene | Os07g0408100 |
| Parent gene annotation |
WD40 repeat-like domain containing protein. (Os07t0408100-01);Si milar to predicted protein. (Os07t0408100-02) |
| Parent gene strand | - |
| Alternative splicing | Os07g0408100_circ_g.1 Os07g0408100_circ_g.3 |
| Support reads | NA |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os07t0408100-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.198651042 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
12678950-12678952(+) |
| Potential amino acid sequence |
MLSWLLPCLGMFEFSDYLLSSCIPNSNITILRSRDQYKSISTRC*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | this study |