Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os07g0408100_circ_g.2 |
ID in PlantcircBase | osa_circ_042546 |
Alias | NA |
Organism | Oryza sativa |
Position | chr7: 12678844-12678971 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRI-long |
Parent gene | Os07g0408100 |
Parent gene annotation |
WD40 repeat-like domain containing protein. (Os07t0408100-01);Si milar to predicted protein. (Os07t0408100-02) |
Parent gene strand | - |
Alternative splicing | Os07g0408100_circ_g.1 Os07g0408100_circ_g.3 |
Support reads | NA |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os07t0408100-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.198651042 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
12678950-12678952(+) |
Potential amino acid sequence |
MLSWLLPCLGMFEFSDYLLSSCIPNSNITILRSRDQYKSISTRC*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | this study |